Recombinant:Article Title: Suppression of metastasis through inhibition of chitinase 3-like 1 expression by miR-125a-3p-mediated up-regulation of USF1
Article Snippet: .. Recombinant mouse Chi3L1, CF R&D systems Cat. # 2649-CH Recombinant human Chi3L1, CF R&D systems Cat. # 2599-CH Lipofectamine® RNAiMAX Reagent Thermo Fisher Cat. # 13778030 Lipofectamine TM 3000 Reagent Thermo Fisher Cat. # L3000001 Invivofectamine TM 3.0 Reagent Thermo Fisher Cat.#: IVF3005 QuantiNova TM SYBR Green PCR Kit QIAGEN Cat. # 208052 High-Capacity cDNA Reverse Transcription Kits Thermo Fisher Cat. # 4368813 miRNeasy Mini Kit QIAGEN Cat. # 217004 easy-BLUE TM Total RNA Extraction Kit iNtRON Cat. # 17061 miScript II RT Kit QIAGEN Cat. # 218160 miScript® SYBR® Green PCR Lit QIAGEN Cat. # 218073 miScript Primer Assays (has-miR-125a-3p) QIAGEN Cat. # MS00008554 miScript Primer Assays (mms-miR-125a-3p) QIAGEN Cat. # MS00011088 miScript Primer Assays (mms-miR-342-3p) QIAGEN Cat. # MS00002184 miScript Primer Assays (RNU6B) QIAGEN Cat. # MS00033740 Secrete-Pair TM Dual Luminescence Assay Kit GeneCopoeia TM Cat. # SPDA-D010 SimpleChIP® Plus Enzymatic Chromatin IP Kit Cell Signaling Cat. # 9004 pO6A5 shuttle vector with U6 promoter Sirion Cat. # SB-P-AV-104-01 Lung tissue from human lung cancer patients and general public donors US Biomax Cat. # LC1503; Cat. # LC241b B16F10 ATCC ATCC® CRL-6475 TM A549 ATCC ATCC® CCL-185 TM H460 ATCC ATCC® HTB-177 TM ..
SYBR Green Assay:Article Title: Suppression of metastasis through inhibition of chitinase 3-like 1 expression by miR-125a-3p-mediated up-regulation of USF1
Article Snippet: .. Recombinant mouse Chi3L1, CF R&D systems Cat. # 2649-CH Recombinant human Chi3L1, CF R&D systems Cat. # 2599-CH Lipofectamine® RNAiMAX Reagent Thermo Fisher Cat. # 13778030 Lipofectamine TM 3000 Reagent Thermo Fisher Cat. # L3000001 Invivofectamine TM 3.0 Reagent Thermo Fisher Cat.#: IVF3005 QuantiNova TM SYBR Green PCR Kit QIAGEN Cat. # 208052 High-Capacity cDNA Reverse Transcription Kits Thermo Fisher Cat. # 4368813 miRNeasy Mini Kit QIAGEN Cat. # 217004 easy-BLUE TM Total RNA Extraction Kit iNtRON Cat. # 17061 miScript II RT Kit QIAGEN Cat. # 218160 miScript® SYBR® Green PCR Lit QIAGEN Cat. # 218073 miScript Primer Assays (has-miR-125a-3p) QIAGEN Cat. # MS00008554 miScript Primer Assays (mms-miR-125a-3p) QIAGEN Cat. # MS00011088 miScript Primer Assays (mms-miR-342-3p) QIAGEN Cat. # MS00002184 miScript Primer Assays (RNU6B) QIAGEN Cat. # MS00033740 Secrete-Pair TM Dual Luminescence Assay Kit GeneCopoeia TM Cat. # SPDA-D010 SimpleChIP® Plus Enzymatic Chromatin IP Kit Cell Signaling Cat. # 9004 pO6A5 shuttle vector with U6 promoter Sirion Cat. # SB-P-AV-104-01 Lung tissue from human lung cancer patients and general public donors US Biomax Cat. # LC1503; Cat. # LC241b B16F10 ATCC ATCC® CRL-6475 TM A549 ATCC ATCC® CCL-185 TM H460 ATCC ATCC® HTB-177 TM ..
Polymerase Chain Reaction:Article Title: Suppression of metastasis through inhibition of chitinase 3-like 1 expression by miR-125a-3p-mediated up-regulation of USF1
Article Snippet: .. Recombinant mouse Chi3L1, CF R&D systems Cat. # 2649-CH Recombinant human Chi3L1, CF R&D systems Cat. # 2599-CH Lipofectamine® RNAiMAX Reagent Thermo Fisher Cat. # 13778030 Lipofectamine TM 3000 Reagent Thermo Fisher Cat. # L3000001 Invivofectamine TM 3.0 Reagent Thermo Fisher Cat.#: IVF3005 QuantiNova TM SYBR Green PCR Kit QIAGEN Cat. # 208052 High-Capacity cDNA Reverse Transcription Kits Thermo Fisher Cat. # 4368813 miRNeasy Mini Kit QIAGEN Cat. # 217004 easy-BLUE TM Total RNA Extraction Kit iNtRON Cat. # 17061 miScript II RT Kit QIAGEN Cat. # 218160 miScript® SYBR® Green PCR Lit QIAGEN Cat. # 218073 miScript Primer Assays (has-miR-125a-3p) QIAGEN Cat. # MS00008554 miScript Primer Assays (mms-miR-125a-3p) QIAGEN Cat. # MS00011088 miScript Primer Assays (mms-miR-342-3p) QIAGEN Cat. # MS00002184 miScript Primer Assays (RNU6B) QIAGEN Cat. # MS00033740 Secrete-Pair TM Dual Luminescence Assay Kit GeneCopoeia TM Cat. # SPDA-D010 SimpleChIP® Plus Enzymatic Chromatin IP Kit Cell Signaling Cat. # 9004 pO6A5 shuttle vector with U6 promoter Sirion Cat. # SB-P-AV-104-01 Lung tissue from human lung cancer patients and general public donors US Biomax Cat. # LC1503; Cat. # LC241b B16F10 ATCC ATCC® CRL-6475 TM A549 ATCC ATCC® CCL-185 TM H460 ATCC ATCC® HTB-177 TM ..
Reverse Transcription:Article Title: Suppression of metastasis through inhibition of chitinase 3-like 1 expression by miR-125a-3p-mediated up-regulation of USF1
Article Snippet: .. Recombinant mouse Chi3L1, CF R&D systems Cat. # 2649-CH Recombinant human Chi3L1, CF R&D systems Cat. # 2599-CH Lipofectamine® RNAiMAX Reagent Thermo Fisher Cat. # 13778030 Lipofectamine TM 3000 Reagent Thermo Fisher Cat. # L3000001 Invivofectamine TM 3.0 Reagent Thermo Fisher Cat.#: IVF3005 QuantiNova TM SYBR Green PCR Kit QIAGEN Cat. # 208052 High-Capacity cDNA Reverse Transcription Kits Thermo Fisher Cat. # 4368813 miRNeasy Mini Kit QIAGEN Cat. # 217004 easy-BLUE TM Total RNA Extraction Kit iNtRON Cat. # 17061 miScript II RT Kit QIAGEN Cat. # 218160 miScript® SYBR® Green PCR Lit QIAGEN Cat. # 218073 miScript Primer Assays (has-miR-125a-3p) QIAGEN Cat. # MS00008554 miScript Primer Assays (mms-miR-125a-3p) QIAGEN Cat. # MS00011088 miScript Primer Assays (mms-miR-342-3p) QIAGEN Cat. # MS00002184 miScript Primer Assays (RNU6B) QIAGEN Cat. # MS00033740 Secrete-Pair TM Dual Luminescence Assay Kit GeneCopoeia TM Cat. # SPDA-D010 SimpleChIP® Plus Enzymatic Chromatin IP Kit Cell Signaling Cat. # 9004 pO6A5 shuttle vector with U6 promoter Sirion Cat. # SB-P-AV-104-01 Lung tissue from human lung cancer patients and general public donors US Biomax Cat. # LC1503; Cat. # LC241b B16F10 ATCC ATCC® CRL-6475 TM A549 ATCC ATCC® CCL-185 TM H460 ATCC ATCC® HTB-177 TM ..
RNA Extraction:Article Title: Suppression of metastasis through inhibition of chitinase 3-like 1 expression by miR-125a-3p-mediated up-regulation of USF1
Article Snippet: .. Recombinant mouse Chi3L1, CF R&D systems Cat. # 2649-CH Recombinant human Chi3L1, CF R&D systems Cat. # 2599-CH Lipofectamine® RNAiMAX Reagent Thermo Fisher Cat. # 13778030 Lipofectamine TM 3000 Reagent Thermo Fisher Cat. # L3000001 Invivofectamine TM 3.0 Reagent Thermo Fisher Cat.#: IVF3005 QuantiNova TM SYBR Green PCR Kit QIAGEN Cat. # 208052 High-Capacity cDNA Reverse Transcription Kits Thermo Fisher Cat. # 4368813 miRNeasy Mini Kit QIAGEN Cat. # 217004 easy-BLUE TM Total RNA Extraction Kit iNtRON Cat. # 17061 miScript II RT Kit QIAGEN Cat. # 218160 miScript® SYBR® Green PCR Lit QIAGEN Cat. # 218073 miScript Primer Assays (has-miR-125a-3p) QIAGEN Cat. # MS00008554 miScript Primer Assays (mms-miR-125a-3p) QIAGEN Cat. # MS00011088 miScript Primer Assays (mms-miR-342-3p) QIAGEN Cat. # MS00002184 miScript Primer Assays (RNU6B) QIAGEN Cat. # MS00033740 Secrete-Pair TM Dual Luminescence Assay Kit GeneCopoeia TM Cat. # SPDA-D010 SimpleChIP® Plus Enzymatic Chromatin IP Kit Cell Signaling Cat. # 9004 pO6A5 shuttle vector with U6 promoter Sirion Cat. # SB-P-AV-104-01 Lung tissue from human lung cancer patients and general public donors US Biomax Cat. # LC1503; Cat. # LC241b B16F10 ATCC ATCC® CRL-6475 TM A549 ATCC ATCC® CCL-185 TM H460 ATCC ATCC® HTB-177 TM ..
Luminescence Assay:Article Title: Suppression of metastasis through inhibition of chitinase 3-like 1 expression by miR-125a-3p-mediated up-regulation of USF1
Article Snippet: .. Recombinant mouse Chi3L1, CF R&D systems Cat. # 2649-CH Recombinant human Chi3L1, CF R&D systems Cat. # 2599-CH Lipofectamine® RNAiMAX Reagent Thermo Fisher Cat. # 13778030 Lipofectamine TM 3000 Reagent Thermo Fisher Cat. # L3000001 Invivofectamine TM 3.0 Reagent Thermo Fisher Cat.#: IVF3005 QuantiNova TM SYBR Green PCR Kit QIAGEN Cat. # 208052 High-Capacity cDNA Reverse Transcription Kits Thermo Fisher Cat. # 4368813 miRNeasy Mini Kit QIAGEN Cat. # 217004 easy-BLUE TM Total RNA Extraction Kit iNtRON Cat. # 17061 miScript II RT Kit QIAGEN Cat. # 218160 miScript® SYBR® Green PCR Lit QIAGEN Cat. # 218073 miScript Primer Assays (has-miR-125a-3p) QIAGEN Cat. # MS00008554 miScript Primer Assays (mms-miR-125a-3p) QIAGEN Cat. # MS00011088 miScript Primer Assays (mms-miR-342-3p) QIAGEN Cat. # MS00002184 miScript Primer Assays (RNU6B) QIAGEN Cat. # MS00033740 Secrete-Pair TM Dual Luminescence Assay Kit GeneCopoeia TM Cat. # SPDA-D010 SimpleChIP® Plus Enzymatic Chromatin IP Kit Cell Signaling Cat. # 9004 pO6A5 shuttle vector with U6 promoter Sirion Cat. # SB-P-AV-104-01 Lung tissue from human lung cancer patients and general public donors US Biomax Cat. # LC1503; Cat. # LC241b B16F10 ATCC ATCC® CRL-6475 TM A549 ATCC ATCC® CCL-185 TM H460 ATCC ATCC® HTB-177 TM ..
Chromatin Immunoprecipitation:Article Title: Suppression of metastasis through inhibition of chitinase 3-like 1 expression by miR-125a-3p-mediated up-regulation of USF1
Article Snippet: .. Recombinant mouse Chi3L1, CF R&D systems Cat. # 2649-CH Recombinant human Chi3L1, CF R&D systems Cat. # 2599-CH Lipofectamine® RNAiMAX Reagent Thermo Fisher Cat. # 13778030 Lipofectamine TM 3000 Reagent Thermo Fisher Cat. # L3000001 Invivofectamine TM 3.0 Reagent Thermo Fisher Cat.#: IVF3005 QuantiNova TM SYBR Green PCR Kit QIAGEN Cat. # 208052 High-Capacity cDNA Reverse Transcription Kits Thermo Fisher Cat. # 4368813 miRNeasy Mini Kit QIAGEN Cat. # 217004 easy-BLUE TM Total RNA Extraction Kit iNtRON Cat. # 17061 miScript II RT Kit QIAGEN Cat. # 218160 miScript® SYBR® Green PCR Lit QIAGEN Cat. # 218073 miScript Primer Assays (has-miR-125a-3p) QIAGEN Cat. # MS00008554 miScript Primer Assays (mms-miR-125a-3p) QIAGEN Cat. # MS00011088 miScript Primer Assays (mms-miR-342-3p) QIAGEN Cat. # MS00002184 miScript Primer Assays (RNU6B) QIAGEN Cat. # MS00033740 Secrete-Pair TM Dual Luminescence Assay Kit GeneCopoeia TM Cat. # SPDA-D010 SimpleChIP® Plus Enzymatic Chromatin IP Kit Cell Signaling Cat. # 9004 pO6A5 shuttle vector with U6 promoter Sirion Cat. # SB-P-AV-104-01 Lung tissue from human lung cancer patients and general public donors US Biomax Cat. # LC1503; Cat. # LC241b B16F10 ATCC ATCC® CRL-6475 TM A549 ATCC ATCC® CCL-185 TM H460 ATCC ATCC® HTB-177 TM ..
other:Article Title: Orphan quality control shapes network dynamics and gene expression.
Article Snippet: REAGENT or RESOURCE SOURCE IDENTIFIER Rabbit polyclonal anti-UFD1 Cell Signaling Technology Cat#13789S; RRID: AB_2798313 Rabbit polyclonal anti-Vinculin Cell Signaling Technology Cat#4650S; RRID: AB_10559207 Rabbit monoclonal anti-WDR5 (D9E1I) Cell Signaling Technology Cat#13105S; RRID: AB_2620133 Goat anti-Mouse IgG (H+L), Superclonal Recombinant Secondary Antibody, Alexa Fluor 488 Thermo Fisher Scientific Cat#A28175; RRID:AB_2536161 Hoechst 33342 Anaspec Cat#AS-83218 Bacterial and virus strains One Shot Stbl3 Chemically Competent E. coli Thermo Fisher Scientific Cat#C737303 Chemicals, peptides, and recombinant proteins TAMRA-labeled MYC-degron1 peptide (TEENVKRRTHNVLERQRRNELKRSFFA LRDQIPEK-(5,6-TAMRA)) Thermo Fisher Scientific N/A TAMRA-labeled MYC-BR wild type peptide (5,6-TAMRA- TEENVKRRTHNVLERQRRNEL KRSFFALRDQIPEK) Thermo Fisher Scientific N/A TAMRA-labeled MYC-HLHLZ wild type peptide (5,6-TAMRA-KAPKVVILKKATAYILSVQAEEQKLI SEEDLLRKRREQLKHKLEQLRNSCA ) Thermo Fisher Scientific N/A TAMRA-labeled MCRS1-degron peptide (5,6-TAMRA-DVDLSLEGPAWKISRKQGVIKLKNNGD) Thermo Fisher Scientific N/A TAMRA-labeled SPT5-degron peptide (5,6-TAMRA -RIKARMSLKDWFAKRKKFKRPPQRLFDAEK) Thermo Fisher Scientific N/A Recombinant Human E1/UBA1 Protein Laboratory of Michael Rapé N/A Recombinant Human UbcH7/UBE2L3 Protein, CF R&D Systems Cat#E2-640-100 Recombinant Human Ubiquitin Protein, CF R&D Systems Cat#U-100H Recombinant Human Ubiquitin Mutant No K Protein, CF R&D Systems Cat#UM-NOK Recombinant Human Ubiquitin Mutant K6R Protein, CF R&D Systems Cat#UM-K6R Recombinant Human Ubiquitin Mutant K11R Protein, CF R&D Systems Cat#UM-K11R Recombinant Human Ubiquitin Mutant K27R Protein, CF R&D Systems Cat#UM-K27R Recombinant Human Ubiquitin Mutant K29R Protein, CF R&D Systems Cat#UM-K29R Recombinant Human Ubiquitin Mutant K33R Protein, CF R&D Systems Cat#UM-K33K Recombinant Human Ubiquitin Mutant K48R Protein, CF R&D Systems Cat# UM-K48R Recombinant Human Ubiquitin Mutant with K48 only Protein, CF R&D Systems Cat#-UM-K480 Recombinant Human Ubiquitin Mutant K63R Protein, CF R&D Systems Cat#-UMK63R Creatine phosphate Sigma-Aldrich Cat#10621714001-5G L-[35S]-Methionine, 1mCi (37MBq), Specific Activity:>800Ci (29.6TBq)/mMole, 50mM Tricine, 10mM BME PerkinElmer Cat#NEG009H001MC Polyethylenimine (PEI), Linear, MW 25000, Transfection Grade Polysciences Cat#23966-1 (Continued on next page) ll OPEN ACCESS Cell 186, 3460–3475.e1–e14, August 3, 2023 e2 Article
|
R&D Systems is a verified supplier 
R&D Systems manufactures this product 